Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13911' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13911 13911 13911 13911 13911 13911

Label GroEL (no label) (no label) (no label) (no label) (no label)

X 747 686 673 655 668 688

Y 215 199 216 192 214 223

%V 0.5516 0.3959 0.5007 0.3101 0.0976 0.1283

Ratio - 0.856 0.238

p-value - 0.635 0.045

RSD 16.436 23.508 13.604

mean 0.474 0.405 0.113

median 0.474 0.405 0.113

maximum 0.552 0.501 0.128

minimum 0.396 0.310 0.098

	control	1 min	10 min

ID	13911	13911	13911	13911	13911	13911
Label	GroEL	(no label)	(no label)	(no label)	(no label)	(no label)
X	747	686	673	655	668	688
Y	215	199	216	192	214	223
%V	0.5516	0.3959	0.5007	0.3101	0.0976	0.1283
Ratio	-	0.856	0.238
p-value	-	0.635	0.045
RSD	16.436	23.508	13.604
mean	0.474	0.405	0.113
median	0.474	0.405	0.113
maximum	0.552	0.501	0.128
minimum	0.396	0.310	0.098

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		GroEL	GroEL
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	1632	1632
	Protein Size (aa)	544	544
	Function
Uniprot	Accession	P28598
	Amino Acids	544
	Function	Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions.
	Gene name	groL
	Gene Ontology	C:cytoplasm [GO:0005737] F:ATP binding [GO:0005524] P:protein refolding [GO:0042026]
	Isoelectric Point	4.4284
	Keywords	ATP-binding Chaperone Complete proteome Cytoplasm Direct protein sequencing Nucleotide-binding Reference proteome Stress response
	Molecular Weight	57424.58
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	GroEL
	Protein name	60 kDa chaperonin
	Query text	GroEL
	References	8 references
	Sequence	MAKEIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIE LEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPVGVRKGME QAVAVAIENLKEISKPIEGKESIAQVAAISAADEEVGSLIAEAMERVGNDGVITIEESKG FTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYILITDKKITNIQEILPVLEQVVQ QGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGDRRKAMLEDIAVLTGGEVIT EDLGLDLKSTQIAQLGRASKVVVTKENTTIVEGAGETDKISARVTQIRAQVEETTSEFDR EKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALNSTRAAVEEGIVSGGGTALVNV YNKVAAVEAEGDAQTGINIVLRALEEPIRQIAHNAGLEGSVIVERLKNEEIGVGFNAATG EWVNMIEKGIVDPTKVTRSALQNAASVAAMFLTTEAVVADKPEENGGGAGMPDMGGMGGM GGMM
	Title	CH60_BACSU
	Uniprot entry	P28598

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13911	13911	13911	13911	13911	13911
Label	GroEL	(no label)	(no label)	(no label)	(no label)	(no label)
X	747	686	673	655	668	688
Y	215	199	216	192	214	223
%V	0.5516	0.3959	0.5007	0.3101	0.0976	0.1283
Ratio	-		0.856		0.238
p-value	-		0.635		0.045
RSD	16.436		23.508		13.604
mean	0.474		0.405		0.113
median	0.474		0.405		0.113
maximum	0.552		0.501		0.128
minimum	0.396		0.310		0.098

Profile

Quantities

Labels

Position on Gel Image 'control_01'