Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13694' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13694 13694 13694 13694 13694 13694

Label AhpF (no label) (no label) (no label) (no label) (no label)

X 710 650 638 618 633 647

Y 272 256 272 247 271 277

%V 0.1846 0.1959 0.0718 0.0698 0.6161 0.4126

Ratio - 0.372 2.703

p-value - 0.002 0.086

RSD 2.974 1.476 19.790

mean 0.190 0.071 0.514

median 0.190 0.071 0.514

maximum 0.196 0.072 0.616

minimum 0.185 0.070 0.413

	control	1 min	10 min

ID	13694	13694	13694	13694	13694	13694
Label	AhpF	(no label)	(no label)	(no label)	(no label)	(no label)
X	710	650	638	618	633	647
Y	272	256	272	247	271	277
%V	0.1846	0.1959	0.0718	0.0698	0.6161	0.4126
Ratio	-	0.372	2.703
p-value	-	0.002	0.086
RSD	2.974	1.476	19.790
mean	0.190	0.071	0.514
median	0.190	0.071	0.514
maximum	0.196	0.072	0.616
minimum	0.185	0.070	0.413

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		AhpF	AhpF
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	1527	1527
	Protein Size (aa)	509	509
	Function
Uniprot	Accession	P42974
	Amino Acids	509
	Function	Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
	Gene name	ahpF
	Gene Ontology	C:plasma membrane [GO:0005886] F:alkyl hydroperoxide reductase activity [GO:0008785] F:electron carrier activity [GO:0009055] F:flavin adenine dinucleotide binding [GO:0050660] F:NAD binding [GO:0051287] F:NADH dehydrogenase activity [GO:0003954] F:protein disulfide oxidoreductase activity [GO:0015035] P:cell redox homeostasis [GO:0045454] P:response to reactive oxygen species [GO:0000302]
	Isoelectric Point	4.6273
	Keywords	Cell membrane Complete proteome Direct protein sequencing Disulfide bond Electron transport FAD Flavoprotein Membrane NAD Oxidoreductase Redox-active center Reference proteome Transport Ubiquinone
	Molecular Weight	54874.4
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	AhpF
	Protein name	NADH dehydrogenase
	Query text	AhpF
	References	4 references
	Sequence	MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNR TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKAEVESKNIMAVPTVYLNGESF GSGRMTLEEILAKMGSGTDASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY VDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRMGEIIVDKHGATSVPGLFAAGDC TDSAYNQIIISMGSGATAALGAFDYLIRN
	Title	DHNA_BACSU
	Uniprot entry	P42974

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13694	13694	13694	13694	13694	13694
Label	AhpF	(no label)	(no label)	(no label)	(no label)	(no label)
X	710	650	638	618	633	647
Y	272	256	272	247	271	277
%V	0.1846	0.1959	0.0718	0.0698	0.6161	0.4126
Ratio	-		0.372		2.703
p-value	-		0.002		0.086
RSD	2.974		1.476		19.790
mean	0.190		0.071		0.514
median	0.190		0.071		0.514
maximum	0.196		0.072		0.616
minimum	0.185		0.070		0.413

Profile

Quantities

Labels

Position on Gel Image 'control_01'